PDB entry 3os9

View 3os9 on RCSB PDB site
Description: Estrogen Receptor
Class: signaling protein
Keywords: Estrogen receptor complex, SIGNALING PROTEIN
Deposited on 2010-09-08, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (76)
      • engineered (240)
    Domains in SCOPe 2.07: d3os9a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (76)
      • engineered (240)
    Domains in SCOPe 2.07: d3os9b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (76)
      • engineered (240)
    Domains in SCOPe 2.07: d3os9c_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (76)
      • engineered (240)
    Domains in SCOPe 2.07: d3os9d_
  • Heterogens: KN1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3os9A (A:)
    snakrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelv
    hminwakrvpgfvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqg
    kcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhi
    hrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvp
    sydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3os9A (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytfstlksleekhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmvvpsydlllemlda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3os9B (B:)
    snakrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelv
    hminwakrvpgfvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqg
    kcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhi
    hrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvp
    sydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3os9B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytfsleekdhihrvldkitdtlihlmakag
    ltlqqqhqrlaqlllilshirhmsnkgmehlysmvvpsydlllemlda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3os9C (C:)
    snakrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelv
    hminwakrvpgfvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqg
    kcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhi
    hrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvp
    sydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3os9C (C:)
    slalsltadqmvsalldaeppilyseysmmglltnladrelvhminwakrvpgfvdltrh
    dqvhllecawleilmiglvwrsmehpgkllfapnllldrnqmveifdmllatssrfrmmn
    lqgeefvclksiillnsgvytfsstlksleekdhihrvldkitdtlihlmakagltlqqq
    hqrlaqlllilshirhmsnkgmehlysvvpsydlllemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3os9D (D:)
    snakrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelv
    hminwakrvpgfvdltrhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqg
    kcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhi
    hrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvp
    sydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3os9D (D:)
    lalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltrhdq
    vhllecawleilmiglvwrsmehpgkllfapnllldrnqmveifdmllatssrfrmmnlq
    geefvclksiillnsgvytleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlll
    ilshirhmsnkgmehlyvpsydllleml