PDB entry 3os5

View 3os5 on RCSB PDB site
Description: SET7/9-Dnmt1 K142me1 complex
Class: transferase
Keywords: Epigenetic modification, SET domain, Protein lysine methyltransferase, Dnmt1, lysine mono-methylation, K142, TRANSFERASE
Deposited on 2010-09-08, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.211
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3os5a1, d3os5a2
  • Chain 'B':
    Compound: Dnmt1
    Database cross-references and differences (RAF-indexed):
    • PDB 3OS5 (0-7)
  • Heterogens: BME, EDO, UNL, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3os5A (A:)
    kdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegkla
    tlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissagegl
    fskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycas
    lghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeap
    ewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3os5A (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqv
    elkafqatq
    

  • Chain 'B':
    No sequence available.