PDB entry 3ord

View 3ord on RCSB PDB site
Description: Structural Evidence for Stabilization of Inhibitor Binding by a Protein Cavity in the Dehaloperoxidase-Hemoglobin from Amphitrite ornata
Class: oxidoreductase
Keywords: globin, peroxidase, OXIDOREDUCTASE
Deposited on 2010-09-06, released 2011-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhp A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orda_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhp A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ordb_
  • Heterogens: HEM, XE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ordA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ordB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk