PDB entry 3orc

View 3orc on RCSB PDB site
Description: crystal structure of an engineered cro monomer bound nonspecifically to DNA
Class: gene regulation/DNA
Keywords: cro, protein-DNA interaction, bacteriophage lambda, repressor, monomer-dimer, helix-turn-helix, complex (gene regulating protein/DNA), gene regulation/DNA complex
Deposited on 1998-04-23, released 1998-12-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.224
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cro repressor)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03040 (0-64)
      • see remark 999 (55-64)
    Domains in SCOPe 2.01: d3orca_
  • Chain 'R':
    Compound: DNA (5'-d(*tp*ap*tp*cp*gp*ap*tp*a)-3')
  • Chain 'S':
    Compound: DNA (5'-d(*tp*ap*tp*cp*gp*ap*tp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3orcA (A:)
    eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgevk
    pfpsn
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.