PDB entry 3orc

View 3orc on RCSB PDB site
Description: crystal structure of an engineered cro monomer bound nonspecifically to dna
Deposited on 1998-04-23, released 1998-12-02
The last revision prior to the SCOP 1.71 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.38
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d3orca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3orcA (A:)
    eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgevk
    pfpsn