PDB entry 3or7

View 3or7 on RCSB PDB site
Description: On the structural basis of modal gating behavior in K+channels - E71I
Class: immune system/transport protein
Keywords: inactivation, alpha-helical, Potassium channel, IMMUNE SYSTEM-TRANSPORT PROTEIN complex
Deposited on 2010-09-06, released 2011-01-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.264
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OR7 (0-218)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OR7 (0-211)
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-102)
      • engineered mutation (49)
      • conflict (68)
    Domains in SCOPe 2.01: d3or7c_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3or7C (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvitattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh