PDB entry 3oqf

View 3oqf on RCSB PDB site
Description: Crystal Structure Analysis of Renin-indole-piperazine inhibitor complexes
Class: hydrolase
Keywords: renin human, aspartyl protease, renin inhibition, hypertension, hydrolase
Deposited on 2010-09-03, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oqfa_
  • Chain 'B':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oqfb_
  • Heterogens: NAG, S51, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oqfA (A:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oqfA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oqfB (B:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oqfB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar