PDB entry 3oqa

View 3oqa on RCSB PDB site
Description: Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
Class: hydrolase
Keywords: Protease, HYDROLASE
Deposited on 2010-09-02, released 2011-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human Immunodeficiency Virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • conflict (24)
      • conflict (34-35)
      • conflict (45)
      • engineered mutation (81)
    Domains in SCOPe 2.04: d3oqaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oqaA (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpsnvigrnlmtqigctlnf