PDB entry 3opk

View 3opk on RCSB PDB site
Description: Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Class: metal binding protein
Keywords: CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CutA, divalent ions binding, METAL BINDING PROTEIN
Deposited on 2010-09-01, released 2010-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divalent-cation tolerance protein cutA
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: cutA, STM4324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3opka_
  • Chain 'B':
    Compound: Divalent-cation tolerance protein cutA
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: cutA, STM4324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3opkb_
  • Chain 'C':
    Compound: Divalent-cation tolerance protein cutA
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: cutA, STM4324
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPA2 (3-117)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3opkc1, d3opkc2
  • Heterogens: NA, ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3opkA (A:)
snamldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyyweg
kleqeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

    Sequence, based on observed residues (ATOM records): (download) 
    >3opkA (A:)
peavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkleqeyevqmilkt
tvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3opkB (B:)
snamldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyyweg
kleqeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

    Sequence, based on observed residues (ATOM records): (download) 
    >3opkB (B:)
mldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkle
qeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3opkC (C:)
snamldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyyweg
kleqeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr