PDB entry 3op5

View 3op5 on RCSB PDB site
Description: Human vaccinia-related kinase 1
Class: transferase
Keywords: Adenosine Triphosphate, Amino Acid Sequence, Binding Sites, Catalytic Domain, Models, Molecular, Molecular Sequence Data, Phosphotransferases, Protein Conformation, Protein Folding, Surface Entropy Reduction, Structural Genomics, Structural Genomics Consortium, SGC, transferase
Deposited on 2010-08-31, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3op5a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3op5b_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3op5c_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3op5d_
  • Heterogens: REB, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3op5A (A:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op5A (A:)
    eqfavgeiitdmaaaawkvglpigqgfgciyladmnssesvgsdapcvvkvepsdngplf
    telkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqki
    yeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdygla
    yrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpw
    ednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlr
    dillqglkaigskddgkldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3op5B (B:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op5B (B:)
    eqfavgeiitdmaaaawkvglpigqfgciyladmnssesvgsdapcvvkvepsdngplft
    elkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiy
    eanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglay
    rycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwe
    dnlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrd
    illqglkaigskddgkldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3op5C (C:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op5C (C:)
    qfavgeiitdmaaaawkvglpigqggciyladmnssesdapcvvkvelftelkfyqraak
    peqiqkwirtrklkylgvpkywgsglhdknksyrfmimdrfgsdlqkiyeanakrfsrkt
    vlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkay
    aadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrd
    skiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigs
    kddgkldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3op5D (D:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op5D (D:)
    vgeiitdmaaaawkvglpiciyladmnssdapcvvkvepsplftelkfyqraakpeqiqk
    wirtrklkylgvpkywgsglhdngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlsl
    rildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkayaadpkr
    chdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrdskiryr
    eniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigskddgkl
    dl