PDB entry 3op4

View 3op4 on RCSB PDB site
Description: Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with NADP+
Class: oxidoreductase
Keywords: 3-ketoacyl-(acyl-carrier-protein) reductase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Rossmann fold, bacterial cell, OXIDOREDUCTASE
Deposited on 2010-08-31, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3op4a_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3op4b_
  • Heterogens: NAP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3op4A (A:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op4A (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3op4B (B:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op4B (B:)
    qfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmal
    nvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrls
    kavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvnt
    vapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvn
    ggmymi