PDB entry 3oow

View 3oow on RCSB PDB site
Description: Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Phosphoribosylaminoimidazole carboxylase, Catalytic subunit, purE, Francisella tularensis subsp. tularensis SCHU S4, Center for Structural Genomics of Infectious Diseases (CSGID), LYASE
Deposited on 2010-08-31, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowa_
  • Chain 'B':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowb_
  • Chain 'C':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowc_
  • Chain 'D':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowd_
  • Chain 'E':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowe_
  • Chain 'F':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowf_
  • Chain 'G':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowg_
  • Chain 'H':
    Compound: Phosphoribosylaminoimidazole carboxylase,catalytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0896, purE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oowh_
  • Heterogens: CL, PO4, FMT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oowA (A:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowA (A:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oowB (B:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowB (B:)
    msvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkv
    iiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmag
    aknaalfaasilqhtdiniakalaefraeqtrfvlenpdpre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oowC (C:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowC (C:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oowD (D:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowD (D:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oowE (E:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowE (E:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oowF (F:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowF (F:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oowG (G:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowG (G:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oowH (H:)
    snamsvqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerg
    lkviiagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaig
    magaknaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oowH (H:)
    svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
    iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
    knaalfaasilqhtdiniakalaefraeqtrfvlenpdpre