PDB entry 3oom

View 3oom on RCSB PDB site
Description: Crystal structure of the ACVR1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor K00507
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-08-31, released 2010-10-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771 (Start-300)
      • engineered mutation (8)
    Domains in SCOPe 2.04: d3ooma_
  • Heterogens: PO4, 507, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oomA (A:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oomA (A:)
    tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrym
    apevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfe
    dmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid