PDB entry 3oog

View 3oog on RCSB PDB site
Description: human cAMP-dependent protein kinase in complex with a small fragment
Class: transferase
Keywords: TRANSFERASE, ATP Binding, Phosphorylation
Deposited on 2010-08-31, released 2011-08-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkaca, Prkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ooga_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oogA (A:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oogA (A:)
    keflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkild
    kqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrri
    grfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgrt
    wtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkv
    rfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfi
    pkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.