PDB entry 3ood

View 3ood on RCSB PDB site
Description: Structure of OpdA Y257F mutant soaked with diethyl 4-methoxyphenyl phosphate for 20 hours.
Class: hydrolase
Keywords: binuclear metallohydrolase, organophosphate hydrolysis, diethyl 4-methoxyphenyl phosphate, bioremediation, Tim Barrel, phosphotriesterase, Binuclear metal ion binding, HYDROLASE
Deposited on 2010-08-31, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphotriesterase
  Species: Agrobacterium tumefaciens [TaxId:358]
  Gene: opdA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93LD7 (0-328)
    • engineered mutation (224)
  Domains in SCOPe 2.07: d3ooda_
• Heterogens: CO, EPL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oodA (A:)
  tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhars
  agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
  eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
  aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpfsaiglegnasalalf
  gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
  ipflrekgvppetlagvtvanparflspt