PDB entry 3ood

View 3ood on RCSB PDB site
Description: Structure of OpdA Y257F mutant soaked with diethyl 4-methoxyphenyl phosphate for 20 hours.
Class: hydrolase
Keywords: binuclear metallohydrolase, organophosphate hydrolysis, diethyl 4-methoxyphenyl phosphate, bioremediation, Tim Barrel, phosphotriesterase, Binuclear metal ion binding, HYDROLASE
Deposited on 2010-08-31, released 2011-11-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.157
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • engineered mutation (224)
    Domains in SCOPe 2.02: d3ooda_
  • Heterogens: CO, EPL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oodA (A:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhars
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpfsaiglegnasalalf
    gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt