PDB entry 3oo3

View 3oo3 on RCSB PDB site
Description: Crystal Structure of the Orf6* (CYP165D3) Monooxygenase Involved in Teicoplanin Biosynthesis
Class: oxidoreductase
Keywords: cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, OXIDOREDUCTASE
Deposited on 2010-08-30, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxy protein
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: Orf6*, tcp19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oo3a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oo3A (A:)
    malplphqrlrldpvpefeelqkagplheydtepgmdgrkqwlvtghdevrailadherf
    ssmrpvddeadrallpgilqaydppdhtrlrrtvapaysarrmerlrprieeiveecldd
    fesvgapvdfvrhaawpipayiaceflgvprddqaelsrmiresresrlprqrtlsglgi
    vnytkrltsgkrrdpgdgmigvivrehgaeisdeelaglaegnlimaaeqmaaqlavavl
    llvthpdqmallrekpelidsateevlrhasiveapaprvaladvrmagrdihagdvltc
    smlatnrapgdrfditrekathmafghgihhcigaplarlqlrvalpavvgrfpslrlav
    peedlrfkpgrpapfaveelplew
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oo3A (A:)
    lplphqrlrldpvpefeelqkagplheydtekqwlvtghdevrailadherfssmrpvda
    llpgilqaydppdhtrlrrtvapaysarrmerlrprieeiveeclddfesvgapvdfvrh
    aawpipayiaceflgvprddqaelsrmiresresrlprqrtlsglgivnytkrltsgkrr
    dpgdgmigvivrehgaeisdeelaglaegnlimaaeqmaaqlavavlllvthpdqmallr
    ekpelidsateevlrhasiveapaprvaladvrmagrdihagdvltcsmlatnrapgdrf
    ditrekathmafghgihhcigaplarlqlrvalpavvgrfpslrlavpeedlrfkpgrpa
    pfaveelplew