PDB entry 3oni

View 3oni on RCSB PDB site
Description: Crystal Structure of the second bromodomain of human BRD2 in complex with the inhibitor JQ1
Class: cell cycle
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Bromodomain, Inhibition, Probe, CELL CYCLE
Deposited on 2010-08-29, released 2010-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.15
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain containing 2, isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, DKFZp313H139, hCG_17503
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3onia_
  • Heterogens: JQ1, NI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oniA (A:)
    smgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkr
    kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oniA (A:)
    lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd