PDB entry 3oni
View 3oni on RCSB PDB site
Description: Crystal Structure of the second bromodomain of human BRD2 in complex with the inhibitor JQ1
Class: cell cycle
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Bromodomain, Inhibition, Probe, CELL CYCLE
Deposited on
2010-08-29, released
2010-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated
2012-03-28, with a file datestamp of
2012-03-23.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.15
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain containing 2, isoform CRA_a
Species: Homo sapiens [TaxId:9606]
Gene: BRD2, DKFZp313H139, hCG_17503
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3onia_ - Heterogens: JQ1, NI, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3oniA (A:)
smgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkr
kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
Sequence, based on observed residues (ATOM records): (download)
>3oniA (A:)
lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd