PDB entry 3on6

View 3on6 on RCSB PDB site
Description: Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution
Class: hydrolase
Keywords: alpha/alpha toroid fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, hydrolase
Deposited on 2010-08-27, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3on6a_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3on6b_
  • Heterogens: CL, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3on6A (A:)
    gitnsdfviqqdntkinnyqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencf
    pntldttvhfdgkddtfvytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqf
    kcinidpyanafnmnseggewmsdltdmkpelherkweidslcypirlayhywkttgdas
    ifsdewltaiakvlktfkeqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvglias
    afrpsddattfqflvpsnffavtslrkaaeilntvnkkpdlakecttlsneveaalkkya
    vynhpkygkiyafevdgfgnqllmddanvpslialpylgdvkvndpiyqntrkfvwsedn
    pyffkgtagegiggphigydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhes
    fhkndpknftrswfawqntlfgelilklvnegkvdllnsiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3on6A (A:)
    yqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencfpntldttvhfdgkddtfv
    ytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqfkcinidpyanafnmnseg
    gewmsdltdmkpelherkweidslcypirlayhywkttgdasifsdewltaiakvlktfk
    eqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
    ffavtslrkaaeilntvnkkpdlakecttlsneveaalkkyavynhpkygkiyafevdgf
    gnqllmddanvpslialpylgdvkvndpiyqntrkfvwsednpyffkgtagegiggphig
    ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkndpknftrswfawqn
    tlfgelilklvnegkvdllnsiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3on6B (B:)
    gitnsdfviqqdntkinnyqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencf
    pntldttvhfdgkddtfvytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqf
    kcinidpyanafnmnseggewmsdltdmkpelherkweidslcypirlayhywkttgdas
    ifsdewltaiakvlktfkeqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvglias
    afrpsddattfqflvpsnffavtslrkaaeilntvnkkpdlakecttlsneveaalkkya
    vynhpkygkiyafevdgfgnqllmddanvpslialpylgdvkvndpiyqntrkfvwsedn
    pyffkgtagegiggphigydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhes
    fhkndpknftrswfawqntlfgelilklvnegkvdllnsiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3on6B (B:)
    yqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencfpntldttvhfdgkddtfv
    ytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqfkcinidpyanafnmnseg
    gewmsdltdmkpelherkweidslcypirlayhywkttgdasifsdewltaiakvlktfk
    eqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
    ffavtslrkaaeilntvnkkpdlakecttlsneveaalkkyavynhpkygkiyafevdgf
    gnqllmddanvpslialpylgdvkvndpiyqntrkfvwsednpyffkgtagegiggphig
    ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkndpknftrswfawqn
    tlfgelilklvnegkvdllnsiq