PDB entry 3omq

View 3omq on RCSB PDB site
Description: Fragment-Based Design of novel Estrogen Receptor Ligands
Class: protein binding
Keywords: Steroid binding, PROTEIN BINDING
Deposited on 2010-08-27, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3omqa_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3omqb_
  • Chain 'C':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: W23, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3omqA (A:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omqA (A:)
    speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
    lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
    tsrfrelklqhkeylcvkamillnssmyplvtdssrklahllnavtdalvwviaksgiss
    qqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3omqB (B:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omqB (B:)
    speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
    lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
    tsrfrelklqhkeylcvkamillnssmyplvtaklahllnavtdalvwviaksgissqqq
    smrlanllmllshvrhasnkgmehllnmkcknvvpvydllleml
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.