PDB entry 3om5

View 3om5 on RCSB PDB site
Description: Crystal structure of B. megaterium levansucrase mutant N252A
Class: transferase
Keywords: five fold beta-propeller, levansucrase, TRANSFERASE
Deposited on 2010-08-26, released 2011-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (223)
    Domains in SCOPe 2.08: d3om5a_
  • Chain 'B':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (223)
    Domains in SCOPe 2.08: d3om5b_
  • Chain 'C':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (223)
    Domains in SCOPe 2.08: d3om5c_
  • Chain 'D':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (223)
    Domains in SCOPe 2.08: d3om5d_
  • Heterogens: CA, P6G, PGE, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3om5A (A:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om5A (A:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3om5B (B:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om5B (B:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3om5C (C:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om5C (C:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3om5D (D:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om5D (D:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv