PDB entry 3om4

View 3om4 on RCSB PDB site
Description: Crystal structure of B. megaterium levansucrase mutant K373A
Class: transferase
Keywords: five fold beta-propeller, levansucrase, TRANSFERASE
Deposited on 2010-08-26, released 2011-03-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (344)
    Domains in SCOPe 2.04: d3om4a_
  • Chain 'B':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (344)
    Domains in SCOPe 2.04: d3om4b_
  • Chain 'C':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (344)
    Domains in SCOPe 2.04: d3om4c_
  • Chain 'D':
    Compound: Levansucrase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5DC07
      • engineered mutation (344)
    Domains in SCOPe 2.04: d3om4d_
  • Heterogens: CA, PEG, PGE, SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3om4A (A:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om4A (A:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3om4B (B:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om4B (B:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3om4C (C:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om4C (C:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3om4D (D:)
    akgndskdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgnt
    idldvwdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswkna
    grvfkdsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnm
    sqpndntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghky
    lvfeantgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiiel
    nddytlkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlg
    yvsntltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyed
    nhstfapsflvnidgsktsvvkdrvleqgqltvded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om4D (D:)
    skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
    wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
    dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
    ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdnhtlrdphyiednghkylvfea
    ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
    lkkvmkplitsntvtdeieranifkkdgkwylftdsrgsamtidgigqddvymlgyvsnt
    ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
    apsflvnidgsktsvvkdrvleqgqltv