PDB entry 3ols

View 3ols on RCSB PDB site
Description: Crystal structure of estrogen receptor beta ligand binding domain
Class: hormone receptor/activator
Keywords: Steroid binding, HORMONE RECEPTOR-ACTIVATOR complex
Deposited on 2010-08-26, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3olsa_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3olsb_
  • Chain 'C':
    Compound: Nuclear receptor coactivator 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor coactivator 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3olsA (A:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3olsA (A:)
    speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
    lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
    tsrfrelklqhkeylcvkamillnssmyplvtdssrklahllnavtdalvwviaksgiss
    qqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3olsB (B:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3olsB (B:)
    speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
    lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
    tsrfrelklqhkeylcvkamillnssmyplvtaklahllnavtdalvwviaksgissqqq
    smrlanllmllshvrhasnkgmehllnmkcknvvpvydllleml
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.