PDB entry 3oln

View 3oln on RCSB PDB site
Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
Class: ligase
Keywords: DNA-BINDING, LIGASE, METAL-BINDING, NUCLEUS, PHOSPHORYLATION, TRANSCRIPTION, TRANSCRIPTION REGULATION, UBL CONJUGATION PATHWAY, ZINC-FINGER, STRUCTURAL GENOMICS CONSORTIUM, SGC, PHOSPHOPROTEIN, All beta proteins
Deposited on 2010-08-26, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.187
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: NIRF, RNF107, RNF107;, UHRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3olna_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: NIRF, RNF107, RNF107;, UHRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3olnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3olnA (A:)
    gstesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvgg
    ihgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnral
    alncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpei
    ssshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3olnA (A:)
    ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
    rgdeftytgsggpsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgr
    kiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrl
    c
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3olnB (B:)
    gstesrrdwgrgmacvgrtrectivpsnhygpipgipvgstwrfrvqvseagvhrphvgg
    ihgrsndgayslvlaggfadevdrgdeftytgsggknlagnkrigapsadqtltnmnral
    alncdaplddkigaesrnwragkpvrvirsfkgrkiskyapeegnrydgiykvvkywpei
    ssshgflvwryllrrddvepapwtsegiersrrlclrlqypagypsdkegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3olnB (B:)
    ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
    rgdeftytgsggkngapsadqtltnmnralalncdaplddkigaesrnwragkpvrvirs
    fkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegier
    srrlc