PDB entry 3olm

View 3olm on RCSB PDB site
Description: Structure and Function of a Ubiquitin Binding Site within the Catalytic Domain of a HECT Ubiquitin Ligase
Class: ligase
Keywords: ubiquitin E3 ligase, LIGASE
Deposited on 2010-08-26, released 2011-03-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase RSP5
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RSP5, MDP1, NPI1, YER125W, SYGP-ORF41
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39940
• Chain 'D':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: UBI4, SCD2, YLL039C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG63 (3-End)
  Domains in SCOPe 2.04: d3olmd_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3olmD (D:)
  snamqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtls
  dyniqkestlhlvlrlrgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3olmD (D:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlr