PDB entry 3ole

View 3ole on RCSB PDB site
Description: Structures of human pancreatic alpha-amylase in complex with acarviostatin II03
Class: hydrolase/hydrolase inhibitor
Keywords: glycosylation, HYDROLASE-HYDROLASE INHIBITOR complex, Acarviostatin II03
Deposited on 2010-08-26, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04746 (Start-495)
      • engineered mutation (286)
    Domains in SCOPe 2.07: d3olea1, d3olea2
  • Heterogens: CA, CL, SO4, NAG, ACI, G6D, GLC, PCA, BGC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oleA (A:)
    qyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oleA (A:)
    yspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwer
    yqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfnp
    gsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskiae
    ymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlggep
    ikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhdn
    qrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgpp
    nnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafgr
    gnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsisn
    saedpfiaihaeskl