PDB entry 3ol2

View 3ol2 on RCSB PDB site
Description: Receptor-ligand structure of Human Semaphorin 4D with Plexin B1.
Class: signaling protein
Keywords: Beta-Propeller, Signalling, Extacellular, SIGNALING PROTEIN
Deposited on 2010-08-25, released 2010-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Semaphorin-4D
    Species: Homo sapiens [TaxId:9606]
    Gene: SEMA4D, C9orf164, CD100, SEMAJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ol2a1, d3ol2a2, d3ol2a3
  • Chain 'B':
    Compound: Plexin-B1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNB1, KIAA0407, PLXN5, SEP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ol2A (A:)
    mafapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisek
    qhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnlt
    sfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrtey
    aipwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdq
    gglrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvg
    lsavcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanyt
    sslnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfv
    stdrgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla
    fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdkskgsy
    rqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv
    yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ol2A (A:)
    fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
    evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
    kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
    pwlnepsfvfadvirkgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtlqk
    kwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavcayn
    lstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlpdk
    tlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrgalh
    kaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqaplafcgkhgtc
    edcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdyrqhffkhggtael
    kcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgvyqclseervknkt
    vfqvvakhvlevkv
    

  • Chain 'B':
    No sequence available.