PDB entry 3oks

View 3oks on RCSB PDB site
Description: Crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis
Class: transferase
Keywords: SSGCID, TRANSFERASE, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2010-08-25, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_2959
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oksa_
  • Chain 'B':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QWJ0
      • expression tag (5)
    Domains in SCOPe 2.07: d3oksb1, d3oksb2
  • Chain 'C':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QWJ0 (4-End)
      • expression tag (3)
      • expression tag (5)
    Domains in SCOPe 2.07: d3oksc1, d3oksc2
  • Chain 'D':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QWJ0 (4-End)
      • expression tag (3)
      • expression tag (5)
    Domains in SCOPe 2.07: d3oksd1, d3oksd2
  • Heterogens: EDO, FMT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oksA (A:)
    gpgsmvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdg
    nrlidlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvr
    gdkrsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfg
    pfapeiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeg
    gfivpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiag
    glplsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimk
    drlgrlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgty
    gnvvrflpplsigddllnegldvleevlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oksA (A:)
    shpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrlidl
    gsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkrsa
    lfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfapei
    yraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfivpa
    dgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglplsa
    vtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlgrl
    qaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvvrf
    lpplsigddllnegldvleevlrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oksB (B:)
    gpgsmvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdg
    nrlidlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvr
    gdkrsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfg
    pfapeiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeg
    gfivpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiag
    glplsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimk
    drlgrlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgty
    gnvvrflpplsigddllnegldvleevlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oksB (B:)
    vshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrlid
    lgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkrs
    alfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfape
    iyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfivp
    adgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglpls
    avtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlgr
    lqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvvr
    flpplsigddllnegldvleevlrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oksC (C:)
    gpgsmvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdg
    nrlidlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvr
    gdkrsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfg
    pfapeiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeg
    gfivpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiag
    glplsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimk
    drlgrlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgty
    gnvvrflpplsigddllnegldvleevlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oksC (C:)
    smvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrl
    idlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdk
    rsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfa
    peiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfi
    vpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglp
    lsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrl
    grlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnv
    vrflpplsigddllnegldvleevlrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oksD (D:)
    gpgsmvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdg
    nrlidlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvr
    gdkrsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfg
    pfapeiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeg
    gfivpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiag
    glplsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimk
    drlgrlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgty
    gnvvrflpplsigddllnegldvleevlrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oksD (D:)
    smvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrl
    idlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdk
    rsalfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfa
    peiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfi
    vpadgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglp
    lsavtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrl
    grlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnv
    vrflpplsigddllnegldvleevlrg