PDB entry 3ok0

View 3ok0 on RCSB PDB site
Description: E35A Mutant of Hen Egg White Lysozyme (HEWL)
Class: hydrolase
Keywords: o-glycosyl, hydrolase
Deposited on 2010-08-24, released 2011-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.157
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (34)
    Domains in SCOPe 2.06: d3ok0a_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ok0A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfasnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl