PDB entry 3ojv

View 3ojv on RCSB PDB site
Description: Crystal Structure of FGF1 complexed with the ectodomain of FGFR1c exhibiting an ordered ligand specificity-determining betaC'-betaE loop
Class: Cytokine/Signaling Protein
Keywords: beta trefoil motif, immunoglobulin-like domain, growth factor, growth factor receptor, extracellular, Cytokine-Signaling Protein complex
Deposited on 2010-08-23, released 2011-12-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.251
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ojva_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ojvb_
  • Chain 'C':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (45)
    Domains in SCOPe 2.04: d3ojvc1, d3ojvc2
  • Chain 'D':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (45)
    Domains in SCOPe 2.04: d3ojvd1, d3ojvd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ojvA (A:)
    mgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqy
    lamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprth
    ygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojvA (A:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ojvB (B:)
    mgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqy
    lamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprth
    ygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojvB (B:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ojvC (C:)
    madntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkp
    dhriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqa
    glpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvntt
    dkemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojvC (C:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevl
    hlrnvsfedageytclagnsiglshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ojvD (D:)
    madntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkp
    dhriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqa
    glpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvntt
    dkemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojvD (D:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevl
    hlrnvsfedageytclagnsiglshhsawltvl