PDB entry 3ojp

View 3ojp on RCSB PDB site
Description: D52N Mutant of Hen Egg White Lysozyme (HEWL)
Class: hydrolase
Keywords: o-glycosyl, hydrolase
Deposited on 2010-08-23, released 2011-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Gallus gallus [TaxId:9031]
  Gene: LYZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • engineered mutation (51)
  Domains in SCOPe 2.04: d3ojpa_
• Heterogens: ACT, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ojpA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstnygilqins
  rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
  qawirgcrl