PDB entry 3oje

View 3oje on RCSB PDB site
Description: Crystal Structure of the Bacillus cereus Enoyl-Acyl Carrier Protein Reductase (Apo form)
Class: Oxidoreductase
Keywords: Enoyl-ACP reductase, Apo form, Rossmann fold, NAD binding, Oxidoreductase
Deposited on 2010-08-22, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.269
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1216
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ojea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ojeA (A:)
    mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
    lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
    safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
    hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
    vtgenihvdsgyhilg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojeA (A:)
    mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
    lvlpcdvtndeeltacfetikqevgtihgvahciafanrddqnisafsltavareakkvm
    teggniltltylgvakasleasvkylandlgqhgirvnaisagpirtldfnsilreieer
    aplrrtttqeevgdtavflfsdlargvtgenihvdsgyhilg