PDB entry 3ojd

View 3ojd on RCSB PDB site
Description: Anti-Indolicidin monoclonal antibody V2D2 (Fab fragment)
Class: immune system
Keywords: Beta-sandwich Immunoglobulin fold, Antigen binding, Secreted protein, anti-indolicidin Fab, surrogate receptor, IMMUNE SYSTEM
Deposited on 2010-08-22, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab V2D2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OJD (0-213)
    Domains in SCOPe 2.07: d3ojda1, d3ojda2
  • Chain 'B':
    Compound: Fab V2D2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OJD (0-223)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ojdA (A:)
divmtqtpaslsasvgesvtitckasgnihnylawyqqkggkspqllvfnastladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstpftfgtgtnleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqggvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktttspivksfnrnec

  • Chain 'B':
    No sequence available.