PDB entry 3ojb

View 3ojb on RCSB PDB site
Description: Crystal structure of C-terminal domain of human galectin-8
Class: sugar binding protein
Keywords: Jelly-roll, Sugar binding protein, Carbohydrate/Sugar Binding
Deposited on 2010-08-21, released 2011-09-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (9-138)
      • expression tag (8)
    Domains in SCOPe 2.05: d3ojba_
  • Chain 'B':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (9-138)
      • expression tag (8)
    Domains in SCOPe 2.05: d3ojbb_
  • Chain 'C':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (9-138)
      • expression tag (8)
    Domains in SCOPe 2.05: d3ojbc_
  • Chain 'D':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (9-138)
      • expression tag (8)
    Domains in SCOPe 2.05: d3ojbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ojbA (A:)
    mghhhhhhmpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlni
    kafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfke
    lssidtleingdihllevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojbA (A:)
    mpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsf
    lqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtle
    ingdihllevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ojbB (B:)
    mghhhhhhmpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlni
    kafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfke
    lssidtleingdihllevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojbB (B:)
    mpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsf
    lqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtle
    ingdihllevr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ojbC (C:)
    mghhhhhhmpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlni
    kafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfke
    lssidtleingdihllevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojbC (C:)
    mpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsf
    lqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtle
    ingdihllevr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ojbD (D:)
    mghhhhhhmpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlni
    kafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfke
    lssidtleingdihllevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ojbD (D:)
    mpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsf
    lqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtle
    ingdihllevr