PDB entry 3oj2

View 3oj2 on RCSB PDB site
Description: Crystal structure of FGF1 complexed with the ectodomain of FGFR2b harboring the A172F Pfeiffer syndrome mutation
Class: Cytokine/Signaling Protein
Keywords: beta trefoil motif, Immunoglobulin-like domain, growth factor, growth factor receptor, extracellular, Cytokine-Signaling Protein complex
Deposited on 2010-08-20, released 2011-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.262
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oj2a_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oj2b_
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (Start-174)
      • engineered mutation (33)
      • see remark 999 (175-220)
    Domains in SCOPe 2.06: d3oj2c1, d3oj2c2
  • Chain 'D':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BEK, FGFR2, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (Start-174)
      • engineered mutation (33)
      • see remark 999 (175-220)
    Domains in SCOPe 2.06: d3oj2d1, d3oj2d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oj2A (A:)
    maegeittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlq
    lsaesvgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaek
    nwfvglkkngsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj2A (A:)
    ppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgq
    ylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprt
    hygqkailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oj2B (B:)
    maegeittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlq
    lsaesvgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaek
    nwfvglkkngsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj2B (B:)
    ppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgq
    ylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprt
    hygqkailflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oj2C (C:)
    maedfvsensnnkrapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkef
    kqehriggykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpil
    qaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsgin
    ssnaevlalfnvteadageyickvsnyigqanqsawltvlpkqqapgreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj2C (C:)
    krapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsginssnaevlalfnv
    teadageyickvsnyigqanqsawltvlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oj2D (D:)
    maedfvsensnnkrapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkef
    kqehriggykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpil
    qaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsgin
    ssnaevlalfnvteadageyickvsnyigqanqsawltvlpkqqapgreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj2D (D:)
    krapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsginssnaevlalfnv
    teadageyickvsnyigqanqsawltvlp