PDB entry 3oj1

View 3oj1 on RCSB PDB site
Description: Structure of the H55D mutant of dehaloperoxidase-hemoglobin A from Amphitrite ornata
Class: oxidoreductase
Keywords: globin, peoxidase, dehalopeoxidase, OXIDOREDUCTASE
Deposited on 2010-08-20, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.225
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3oj1a_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3oj1b_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oj1A (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oj1B (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk