PDB entry 3oii

View 3oii on RCSB PDB site
Description: Crystal structure of Saccharomyces Cerevisiae Nep1/Emg1 bound to S-adenosylhomocysteine
Class: ribosomal protein
Keywords: EMG1, scNEP1, SPOUT, ribosome biogenesis, methyltransferase, rRNA processing, RIBOSOMAL PROTEIN
Deposited on 2010-08-19, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: essential for mitotic growth 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EMG1, NEP1, YLR186W, L9470.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3oiia_
  • Chain 'B':
    Compound: essential for mitotic growth 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EMG1, NEP1, YLR186W, L9470.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3oiib_
  • Heterogens: SAH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oiiA (A:)
    gmvedsrvrdalkggdqkalpaslvpqappvltskdkitkrmivvlamaslethkissng
    pggdkyvllncddhqgllkkmgrdisearpdithqclltlldspinkagklqvyiqtsrg
    ilievnptvriprtfkrfsglmvqllhklsirsvnseekllkviknpitdhlptkcrkvt
    lsfdapvirvqdyiekldddesicvfvgamargkdnfadeyvdekvglsnyplsasvacs
    kfchgaedawnil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oiiA (A:)
    ppvltskdkitkrmivvlamaslethkiyvllncddhqgllkkmgrdisearpdithqcl
    ltlldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhklsirsvnse
    ekllkviknpitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvgamargkdnf
    adeyvdekvglsnyplsasvacskfchgaedawnil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oiiB (B:)
    gmvedsrvrdalkggdqkalpaslvpqappvltskdkitkrmivvlamaslethkissng
    pggdkyvllncddhqgllkkmgrdisearpdithqclltlldspinkagklqvyiqtsrg
    ilievnptvriprtfkrfsglmvqllhklsirsvnseekllkviknpitdhlptkcrkvt
    lsfdapvirvqdyiekldddesicvfvgamargkdnfadeyvdekvglsnyplsasvacs
    kfchgaedawnil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oiiB (B:)
    ppvltskdkitkrmivvlamaslethvllncddhqgllkkmgrdisearpdithqclltl
    ldspinkagklqvyiqtsrgilievnptvriprtfkrfsglmvqllhklsirskllkvik
    npitdhlptkcrkvtlsfdapvirvqdyiekldddesicvfvgamargkdnfadeyvdek
    vglsnyplsasvacskfchgaedawnil