PDB entry 3oid

View 3oid on RCSB PDB site
Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (complex with NADP and TCL)
Class: oxidoreductase
Keywords: Fatty acid synthesis, Enoyl-ACP Reductases, FabL, Rossmann-like fold, NADPH binding, OXIDOREDUCTASE
Deposited on 2010-08-19, released 2011-01-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (Start-249)
      • expression tag (250)
    Domains in SCOPe 2.05: d3oida_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (0-249)
      • expression tag (250)
    Domains in SCOPe 2.05: d3oidb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (Start-249)
      • expression tag (250)
    Domains in SCOPe 2.05: d3oidc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (Start-249)
      • expression tag (250)
    Domains in SCOPe 2.05: d3oidd_
  • Heterogens: TCL, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oidA (A:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oidA (A:)
    qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan
    vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq
    eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav
    sggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiiv
    dggrsllvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oidB (B:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oidB (B:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oidC (C:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oidC (C:)
    nkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkanv
    gqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaqe
    aaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnavs
    ggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivd
    ggrsllvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oidD (D:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oidD (D:)
    nkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkanv
    gqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaqe
    aaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnavs
    ggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivd
    ggrsllvl