PDB entry 3ogp

View 3ogp on RCSB PDB site
Description: Crystal Structure of 6s-98S FIV Protease with Darunavir bound
Class: hydrolase/hydrolase inhibitor
Keywords: aspartyl protease, HIV-like FIV chimera, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-17, released 2011-06-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FIV Protease
    Species: Feline immunodeficiency virus [TaxId:11673]
    Gene: pol, PR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-115)
      • engineered mutation (36)
      • engineered mutation (54)
      • engineered mutation (58)
      • engineered mutation (97-99)
    Domains in SCOPe 2.01: d3ogpa_
  • Chain 'B':
    Compound: FIV Protease
    Species: Feline immunodeficiency virus [TaxId:11673]
    Gene: pol, PR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-115)
      • engineered mutation (36)
      • engineered mutation (54)
      • engineered mutation (58)
      • engineered mutation (97-99)
    Domains in SCOPe 2.01: d3ogpb_
  • Heterogens: 017, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ogpA (A:)
ynkvgttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigig
ggkrgtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >3ogpA (A:)
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3ogpB (B:)
ynkvgttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigig
ggkrgtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >3ogpB (B:)
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm