PDB entry 3ogj

View 3ogj on RCSB PDB site
Description: Crystal structure of partial apo (92-227) of cGMP-dependent protein kinase
Class: transferase
Keywords: serine/threonine kinase, TF2I and IRAG, TRANSFERASE
Deposited on 2010-08-16, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRKG1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ogja_
  • Chain 'B':
    Compound: PRKG1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ogjb_
  • Chain 'C':
    Compound: PRKG1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ogjc_
  • Chain 'D':
    Compound: PRKG1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ogjd_
  • Heterogens: CMP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ogjA (A:)
    gsgshvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciike
    gdvgslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaid
    rqcfqtimmrtglikhtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ogjA (A:)
    shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
    gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
    fqtimmrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ogjB (B:)
    gsgshvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciike
    gdvgslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaid
    rqcfqtimmrtglikhtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ogjB (B:)
    shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
    gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
    fqtimmr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ogjC (C:)
    gsgshvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciike
    gdvgslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaid
    rqcfqtimmrtglikhtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ogjC (C:)
    shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
    gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
    fqtimmr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ogjD (D:)
    gsgshvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciike
    gdvgslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaid
    rqcfqtimmrtglikhtey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ogjD (D:)
    shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
    gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
    fqtimmr