PDB entry 3ogb

View 3ogb on RCSB PDB site
Description: Sperm whale myoglobin mutant H64W deoxy-form
Class: oxygen transport
Keywords: Myoglobin, ligand migration pathways, oxygen storage, OXYGEN TRANSPORT
Deposited on 2010-08-16, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (64)
      • variant (122)
    Domains in SCOPe 2.06: d3ogba_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ogbA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkwgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg