PDB entry 3og7

View 3og7 on RCSB PDB site
Description: B-Raf Kinase V600E oncogenic mutant in complex with PLX4032
Class: transferase
Keywords: B-Raf, BRAF, PROTO-ONCOGENE, V600E, Kinase, TRANSFERASE
Deposited on 2010-08-16, released 2010-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.214
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AKAP9-BRAF fusion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5IBP5 (17-288)
      • engineered mutation (90)
      • engineered mutation (111-112)
      • engineered mutation (119)
      • engineered mutation (130)
      • engineered mutation (156)
      • engineered mutation (235)
      • engineered mutation (241)
      • engineered mutation (256)
      • engineered mutation (274)
      • engineered mutation (277)
      • engineered mutation (281)
      • engineered mutation (284)
      • engineered mutation (288)
    Domains in SCOPe 2.04: d3og7a_
  • Chain 'B':
    Compound: AKAP9-BRAF fusion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5IBP5 (17-288)
      • engineered mutation (90)
      • engineered mutation (111-112)
      • engineered mutation (119)
      • engineered mutation (130)
      • engineered mutation (156)
      • variant (168)
      • engineered mutation (235)
      • engineered mutation (241)
      • engineered mutation (256)
      • engineered mutation (274)
      • engineered mutation (277)
      • engineered mutation (281)
      • engineered mutation (284)
      • engineered mutation (288)
    Domains in SCOPe 2.04: d3og7b_
  • Heterogens: 032, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3og7A (A:)
    mkkghhhhhhgsrdaaddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtapt
    pqqlqafknevgvlrktrhvnillfmgystapqlaivtqwcegsslyhhlhasetkfemk
    klidiarqtargmdylhaksiihrdlksnniflhedntvkigdfglateksrwsgshqfe
    qlsgsilwmapevirmqdsnpysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgr
    gslspdlskvrsncpkrmkrlmaeclkkkrderpsfprilaeieelare
    

    Sequence, based on observed residues (ATOM records): (download)
    >3og7A (A:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystapqlaivtqwcegsslyhhlhasfemkklidiarqtargmdylhaks
    iihrdlksnniflhedntvkigdfggsilwmapevirnpysfqsdvyafgivlyelmtgq
    lpysninnrdqiiemvgrgslspdlskvrsncpkrmkrlmaeclkkkrderpsfprilae
    ieelare
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3og7B (B:)
    mkkghhhhhhgsrdaaddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtapt
    pqqlqafknevgvlrktrhvnillfmgystapqlaivtqwcegsslyhhlhasetkfemk
    klidiarqtargmdylhaksiihrdlksnniflhedntvkigdfglateksrwsgshqfe
    qlsgsilwmapevirmqdsnpysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgr
    gslspdlskvrsncpkrmkrlmaeclkkkrderpsfprilaeieelare
    

    Sequence, based on observed residues (ATOM records): (download)
    >3og7B (B:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystapqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmdylh
    aksiihrdlksnniflhedntvkigdfglategsilwmapevirnpysfqsdvyafgivl
    yelmtgqlpysninnrdqiiemvgrgslspdlskvrsncpkrmkrlmaeclkkkrderps
    fprilaeieelare