PDB entry 3ofw

View 3ofw on RCSB PDB site
Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Carribean sea anemone stichodactyla helianthus
Class: hydrolase/hydrolase inhibitor
Keywords: Kunitz Type, serine protease inhibitor, serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-16, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type proteinase inhibitor SHPI-1
    Species: Stichodactyla helianthus [TaxId:6123]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31713 (4-57)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3ofwa1, d3ofwa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ofwA (A:)
    eaeasicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ofwA (A:)
    easicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr