PDB entry 3ofu

View 3ofu on RCSB PDB site
Description: Crystal Structure of Cytochrome P450 CYP101C1
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2010-08-16, released 2011-05-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofua_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofub_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofuc_
  • Chain 'D':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofud_
  • Chain 'E':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofue_
  • Chain 'F':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_2249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ofuf_
  • Heterogens: HEM, ID3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ofuA (A:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ofuB (B:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ofuC (C:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ofuD (D:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ofuD (D:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrgsmtveql
    kqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtvaam
    igmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirkgd
    lvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflrew
    lggmpefalapdkavtmkggnvgactalplvwra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ofuE (E:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ofuE (E:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqlmtveqlkqaa
    ddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtvaamigmv
    alhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirkgdlvyl
    psvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflrewlggm
    pefalapdkavtmkggnvgactalplvwra
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ofuF (F:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
    qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
    amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
    gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
    ewlggmpefalapdkavtmkggnvgactalplvwra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ofuF (F:)
    mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
    wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
    arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqlmtveqlkqaa
    ddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtvaamigmv
    alhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirkgdlvyl
    psvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflrewlggm
    pefalapdkavtmkggnvgactalplvwra