PDB entry 3ofm

View 3ofm on RCSB PDB site
Description: Structure of a human CK2alpha prime, the paralog isoform of the catalytic subunit of protein kinase CK2 from Homo sapiens
Class: transferase/transferase inhibitor
Keywords: eukaryptic protein kinase fold, phospho transferase, ATP binding, Phosphorylation, Cytoplasm and nucleus, transferase-transferase inhibitor complex
Deposited on 2010-08-15, released 2011-01-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CK2A2, CSNK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ofma_
  • Heterogens: 4B0, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ofmA (A:)
    mpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeaini
    tnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinnt
    dfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwgla
    efyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdny
    dqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspeald
    lldkllrydhqqrltakeamehpyfypvvkeqsqpsadnavlssgltaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ofmA (A:)
    srarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnervv
    vkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqlyq
    iltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpaq
    eynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvria
    kvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkllr
    ydhqqrltakeamehpyfypvvkeq