PDB entry 3of9

View 3of9 on RCSB PDB site
Description: Structural Basis for Irreversible Inhibition of Human Cathepsin L by a Diazomethylketone Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-14, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL1, CTSL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3of9a_
  • Heterogens: I0X

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3of9A (A:)
    eaprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgp
    qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
    kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
    nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv