PDB entry 3of6

View 3of6 on RCSB PDB site
Description: Human pre-T cell receptor crystal structure
Class: Immune System
Keywords: Ig fold, Immune System
Deposited on 2010-08-13, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.179
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OF6
    Domains in SCOPe 2.07: d3of6a1, d3of6a2
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OF6
    Domains in SCOPe 2.07: d3of6b1, d3of6b2
  • Chain 'C':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OF6
    Domains in SCOPe 2.07: d3of6c1, d3of6c2
  • Chain 'D':
    Compound: Pre T-cell antigen receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Pre T-cell antigen receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Pre T-cell antigen receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3of6A (A:)
    agshmgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldk
    sglpsdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
    eqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgradctsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3of6A (A:)
    mgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglp
    sdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3of6B (B:)
    agshmgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldk
    sglpsdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
    eqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgradctsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3of6B (B:)
    mgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglp
    sdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3of6C (C:)
    agshmgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldk
    sglpsdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
    eqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgradctsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3of6C (C:)
    hmgvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksgl
    psdrffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqp
    alndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.