PDB entry 3oey

View 3oey on RCSB PDB site
Description: Crystal structure of InhA_T266E:NADH complex
Class: oxidoreductase
Keywords: enoyl-reductase, OXIDOREDUCTASE
Deposited on 2010-08-13, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: inhA, MT1531, MTCY277.05, Rv1484
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y6 (Start-268)
      • engineered mutation (265)
    Domains in SCOPe 2.06: d3oeya_
  • Heterogens: NAD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oeyA (A:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggaheqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeyA (A:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
    callsdwlpattgdiiyadggaheqll