PDB entry 3oeh

View 3oeh on RCSB PDB site
Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
Class: hydrolase
Keywords: ATP synthase, ATP phosphatase, f1f0 ATPase, ATP synthesis, hydrolase, ADP, po4, mitochondria
Deposited on 2010-08-12, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehd1, d3oehd2, d3oehd3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehe1, d3oehe2, d3oehe3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehf1, d3oehf2, d3oehf3
  • Chain 'G':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oehg_
  • Chain 'H':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oehh1, d3oehh2
  • Chain 'I':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oehi_
  • Chain 'J':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehm1, d3oehm2, d3oehm3
  • Chain 'N':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehn1, d3oehn2, d3oehn3
  • Chain 'O':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oeho1, d3oeho2, d3oeho3
  • Chain 'P':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oehp_
  • Chain 'Q':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oehr_
  • Chain 'S':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehv1, d3oehv2, d3oehv3
  • Chain 'W':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehw1, d3oehw2, d3oehw3
  • Chain 'X':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00830
      • engineered mutation (284)
    Domains in SCOPe 2.06: d3oehx1, d3oehx2, d3oehx3
  • Chain 'Y':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oehD (D:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehD (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oehE (E:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehE (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oehF (F:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehF (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oehG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi
    ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq
    spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr
    ysilynrtrqavitnelvdiitgass
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oehH (H:)
    aeaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevm
    egsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdarea
    aeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehH (H:)
    klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
    gfatvqpdsqlcvtaieaeniknllaeakknvsssdareaaeaaiqvevlenlqsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3oehI (I:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehI (I:)
    isyaaylnvaaqairsktelqtasvlnrsqtdafytqyknaseptpitk
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3oehM (M:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehM (M:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3oehN (N:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehN (N:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3oehO (O:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehO (O:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3oehP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
    livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
    fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktieqdtdanvprdlf
    eytlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdi
    itgass
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3oehR (R:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehR (R:)
    yaaylnvaaqairtelqtasvlnrsqtdafytqy
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3oehV (V:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehV (V:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3oehW (W:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehW (W:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3oehX (X:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oehX (X:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsafgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.