PDB entry 3oe7

View 3oe7 on RCSB PDB site
Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
Class: hydrolase
Keywords: ATP SYNTHASE, ATP PHOSPHATASE, F1F0 ATPASE, ATP SYNTHESIS, ADP, PO4, mitochondria, HYDROLASE
Deposited on 2010-08-12, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.192
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7d1, d3oe7d2, d3oe7d3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7e1, d3oe7e2, d3oe7e3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7f1, d3oe7f2, d3oe7f3
  • Chain 'G':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38077 (0-End)
      • engineered mutation (269)
    Domains in SCOPe 2.06: d3oe7g_
  • Chain 'H':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7h1, d3oe7h2
  • Chain 'I':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7i_
  • Chain 'J':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7m1, d3oe7m2, d3oe7m3
  • Chain 'N':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7n1, d3oe7n2, d3oe7n3
  • Chain 'O':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7o1, d3oe7o2, d3oe7o3
  • Chain 'P':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38077 (0-End)
      • engineered mutation (269)
    Domains in SCOPe 2.06: d3oe7p_
  • Chain 'Q':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7r_
  • Chain 'S':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7v1, d3oe7v2, d3oe7v3
  • Chain 'W':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7w1, d3oe7w2, d3oe7w3
  • Chain 'X':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oe7x1, d3oe7x2, d3oe7x3
  • Chain 'Y':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38077 (0-End)
      • engineered mutation (269)
  • Chain 'Z':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG, PO4

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oe7D (D:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7D (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oe7E (E:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7E (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oe7F (F:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7F (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oe7G (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdtitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7G (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
    elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
    gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
    psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
    silynrtrqavitnelvdtitgass
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oe7H (H:)
    eaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevme
    gsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdareaa
    eaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7H (H:)
    klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
    gfatvqpdsqlcvtaieaplesfseniknllaeakknvsssreaaeaaiqvevlenlqsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3oe7I (I:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7I (I:)
    isyaaylnvaaqairstelqtasvlnrsqtdafytqyknaseptpitk
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3oe7M (M:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7M (M:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3oe7N (N:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7N (N:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3oe7O (O:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7O (O:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3oe7P (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdtitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7P (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
    livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
    fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktidtdanvprdlfey
    tlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdtit
    gass
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3oe7R (R:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7R (R:)
    yaaylnvaaqairqtasvlnrsqtdafytqy
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3oe7V (V:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7V (V:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3oe7W (W:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7W (W:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3oe7X (X:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oe7X (X:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.